Show a calculation of change in standard reduction potential that explains why succinate is not oxidized to fumarate using NAD+ as a cofactor
Q: One of your colleagues has obtained a sample of muscle phosphorylase b that is known to be…
A: Glycogen is storage-type homopolysaccharides that contain two types of glucose polymers: amylose:…
Q: Glucose and fructose are both C6H12O6. What is the structural difference between them? Glucose is a…
A: carbohydrates are carbon molecules which undergo oxidation to yield energy. Carbohydrates are…
Q: Give an overview of Tumor necrosis factor (TNF) signaling, and discuss the nature of the TNF ligand…
A: TNF signaling is an apoptotic signaling pathway that causes programmed cell death due to external…
Q: Why do enzymes contain metals? What general reaction types to metalloenzymes catalyze?
A: Enzymes are biological catalysts proteinateous in nature that catalyze large number of biochemical…
Q: 2. During glycolysis, glucose is converted to pyruvate. Pyruvate then is converted to Acetyl coA and…
A: During glycolysis, one molecule of glucose is converted into two molecules of pyruvate. The two…
Q: 5. Describe the role of His in the catalytic mechanism shown.
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: Which of the following is an anomer of B-D-gulopyranose? O ОН I ОН т ОН I I ОН CH2OH II- Б ОН CH2OH…
A: Anomers are cyclic monosaccharides differing from each other in the configuration at carbon no -1…
Q: Question 5 An a-helix has the sequence: NH3-Ser-Glu-Gly-Asp-Trp-Gln-Leu-His-Val-Phe-Ala-Lys-Val-Glu-…
A: Alpha helix is a type of secondary structure of proteins. It is the rod-like structure formed when…
Q: In the experimental set up to show that "CO, is given out during respiration", name the substance…
A: Respiration is a metabolic process that all organisms go through. It is a biochemical process that…
Q: What statement is true regarding LDL? Because the LDL is plasma lipoproteins with a lipid bilayer,…
A: Lipoproteins are triacylglycerols, phospholipids, cholesterol, and cholesterol esters associated…
Q: a) This molecule is produced when what amino acid is transaminated? b) What are the one- and…
A: Introduction Amino acids are the building blocks of protein. Two amino acids are joined by peptide…
Q: Draw the electron pushing mechanism
A: Electron pushing mechanism shows the jumping of electrons in the substrate and/or reaction…
Q: Lactate dehydrogenase (LDH): structure, characteristics, isoforms and their diagnostic significance.
A: Enzymes are bio-catalyst that participate in biochemical process and they are highly specific in…
Q: ATP is a source of free energy that drives unfavorable reactions. Which of the processes are coupled…
A: The free energy changes in chemical reactions are denoted by ΔG. ∆G = ∆H − T∆S where ∆H is the…
Q: The metabolic function of the pentose phosphate pathway is: act as a source of ADP biosynthesis O…
A: The breakdown of glucose, in glycolysis provides the starting molecule required for the pentose…
Q: 1. Describe the role of Cys in the catalytic mechanism shown. 2. Describe/predict the…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: true/false: N-acetyl glutamate regulates the urea cycle by increasing the transcription of the…
A: Urea cycle is an important catabolic pathway in which ammonia is removed from the body in the form…
Q: Which enzyme activity would be inhibited if fluorodeoxyuridine-5 monophosphate is present?…
A: The compound fluorodeoxyuridine 5’-monophosphate (FdUMP) is a compound that has similar structure to…
Q: What is the amount of sucrose hydrolyzed (in mg/mL) at optimum temperature ?
A: Enzymes are high molecular weight protein molecules that catalyse biochemical reactions. The…
Q: Label: 1) the type of chemical bonds between the amino acids (e.g. covalent bond, ionic bond,…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: true/false: Transamination reactions yield an a-keto acid and an amino acid.
A: The amino acids undergo reactions like transamination and deamination. As the name suggests the…
Q: When glycogen is degraded (catabolized), all of the following occur in both liver and muscle EXCEPT…
A: Glycogenolysis is the process of breaking down the stored glycogen into simple sugar units. It…
Q: De novo purine biosynthesis is a 10-step pathway that builds the purine rings one atom, or one group…
A: Nucleotides are building blocks of nucleotides. It consists of a nitrogenous base linked to 1'…
Q: 3. Attach the structures below to draw a sphingolipid. CH3-(CH2) 12-CH=CH-CH-OH sphingosine CHINH,…
A: Lipids are a chemically diverse group of biomolecules that have two things in common: low…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: All enzymes of the citric acid cycle are located in the mitochondrial matrix, except succinate…
A: Cellular respiration is the process how biochemical energy is generated from food. It involves the…
Q: Identify two (2) functions of lipids in the body. Explain each function in 2 sentences.
A: Lipids are a very important class of biological molecule. Lipids are a broader class of molecule…
Q: The Electron Transport System (ETS) The ETS must generate a hydrogen gradient (proton motive force)…
A: Since you have posted multiple questions, we will provide the solution only to the first question as…
Q: Name four amino acids that can be synthesized using pyruvate as a starting material. What one(s) of…
A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…
Q: describe the functions of the pentose phosphate pathway. Explain how NADPH functions in biosynthesis…
A: In a cell, glucose 6-phosphate has two possible fates: be oxidised into carbon dioxide and water by…
Q: How many hydrogen bonds exist between this DNA strand and its complementary strand? 5'-CACGGGG-3'
A: Deoxyribonucleic acid (DNA) is a double stranded polynucleotide coiled around a central axis to form…
Q: Suppose a student rinses their buret with water instead of sodium hydroxide, leaving water in the…
A: Introduction The titration is a chemical process by which the quantity of one substance of a sample…
Q: The specific activity of a pure preparation of pyruvate kinase (PK) assayed in the direction of…
A: Pyruvate kinase (PK): The role of pyruvate kinase is to catalyze the final phase of glycolysis,…
Q: What else? What are cofactors? Carboxypeptidase requires a Zn²+ cofactor for the hydrolysis of the…
A: Since in the question it is mentioned to answer any three questions, question 2, 5 & 6 will be…
Q: Mechanism of action of electron transport inhibitors. Amital.
A: INTRODUCTION : First of all, there is no electron transport inhibitor called Amital, it is a wrong…
Q: Draw the structure of ethanolamine sphingomyelin formed from linoleic acid Draw the structure of…
A: Sphingomyelin is an important component of both the monolayer of phospholipids in lipoproteins and…
Q: Experiment: Lipids Qualitative Tests Test Performed: Translucent Test Procedure 1. Fold your…
A: Lipids are a chemically diverse group of biomolecules with two common characteristics: low…
Q: What causes darkly-colored urine in patients with alkaptonuria? O reduction of acetoacetyl-CoA…
A: Amino acids can be degraded & certain amino acid can be inter-converted to another amino acid…
Q: The substitution of His 64 of carbonic anhydrase II with Ala results in a sharp decrease in the…
A: Carbonic anhydrase II is the enzyme that catalyzes the formation of H2CO3 from CO2 and H2O, and…
Q: 3. Predict the effect of each of the following amino acid substitutions on the KM and keat of the…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Vasopressin is a hormone that plays an important role in social behavior, sexual motivation, and…
A: Recall that: Amino acid sequences are written with N-terminal amino acid on the left and…
Q: In 1958, Meselson and Stahl conducted an experiment to determine which of the three proposed methods…
A: Three important experiments contributed to our current understanding of DNA structure and function:…
Q: What explains the side effect of "acetone-breath" on dieters following a low carbohydrate diet? O…
A: Ketone bodies refers to the following compounds: acetone, acetoacetate & β-hydroxybutyrate. They…
Q: Biochemistry Plz answer these 2 question 1. How to differentiate between beta-amylase from alpha…
A: “Since you have asked multiple question, we will solve the first question for you. If you want any…
Q: 2. What is the terms used to describe what is happening to the members of the electron transport…
A: Electron transport system occurs in the inner mitochondrial membrane. This system causes a series of…
Q: Starch is a polysaccharide 1.Is starch positive in Bial‘s test？（what color ？） 2.Is starch positive…
A: Introduction: Polysaccharides are polymers of D-glucose that are joined together by glycosidic…
Q: Answer the Questions below: 1. Based on the experiment above, what is the means of detecting the…
A: Lipids are hydrophobic compounds that are usually made up of an alcohol backbone and a long chain…
Q: The enzyme-catalysed conversion of a substrate at 25 °C has a Michaelis constant of 70 μmol dm and a…
A: The enzyme follows Michaelis Menton's kinetics. Kcat is the enzyme turnover number and it defines…
Q: . What is the nucleotide sequence of the complementary strand of the DNA molecule:…
A: DNA is the genetic material in most organisms. During transcription RNA Polymerase synthesizes the…
Q: Fill up the table below to summarize the confirmatory test for casein and whey. Test Sample…
A: Casein and whey are the 2 important classes of proteins in milk. The human milk composition is…
Step by step
Solved in 2 steps
- A mutant version of DADH can use NADP+ as a cofactor for isopropanol oxidation. Velocity data was collected from reactions at a series of NADP+ concentrations. The following trendline was obtained for a Lineweaver-Burk plot of the data: y = 0.00007x + 0.0014 Note that the NADP+ substrate concentrations are in mM and the reaction velocity was measured in nmol/min. Calculate the Km and Vmax for DADH with this substrate. Show your work.Define the reason behind the increase in absorbance of NADH at 340?Calculate the biochemical standard cell potential for the oxidation of NADH by molecular oxygen O2 + 2NADH + 2 H+ → 2H2O + 2NAD+
- The enzyme lactate dehydrogenase catalyzes the reversible reaction lactate (CH3 CHOHCOO )+NAD* рyruvate (CH3 COCOO) + NADH + H+ Given the standard reduction potentials CH3 СОСОО + 2H+ + 2е CH3 CHОНСО" E°'= -0. 185 V NADŤ + H+ + 2e- → NADH = -0. 320 V E°' would you expect the reaction to be spontaneous in the forward or reverse direction under biochemical standard state conditions? How could you change the reaction conditions to force the reaction to be spontaneous in the opposite direction? Please explain your answer.Recall that beta-hydroxybutyrate is oxidized by the enzyme beta-hydroxybutyrate dehydrogenase withsimultaneous reduction of NAD+ to NADH. How might this affect the reduction potential at Complex I in theelectron transport chain? (Note: you will need to use the form of the Nernst equation that uses non-standardconditions.)A dialyzed pigeon liver extract will catalyze the conversion of acetyl-CoAto palmitate and CoASH if supplied with Mg2+, NADPH, ATP, HCO3-, andcitrate.(a) If H14CO3– is supplied, what compounds will become labeled (permanently or transiently) during the course of the reaction? In whatcompounds will 14C accumulate?(b) Explain the role of citrate in this reaction.
- NADP+ and control are switched in the Km values (graph is not clear on this), would this make NADP+ an inhibitor?NADH will not change the Vmax for ADH but does increase the Km for the NAD+ substrate. What type of inhibition is occurring relative to the NAD+ substrate?explain in quantitative terms the circumstances under which the following reaction can porceed; L-malate + NAD+ (forward arrow) oxaloacetate + NADH + H+ delta G' standard = +29.7 KJ/mol
- Calculate the reduction potential of cytochrome a3 (°' = 0.385 V) at 25.0°C when the Fe3+ form = 87.0 μM and the Fe2+ form = 25.0 μM. 0.440 V 0.353 V 0.417 V 0.387 VBegining with 1 M concentrations of each reactant and product at pH=7 and 25.0 degrees C, calculate the K'eq of the reaction Pyruvate + NADH Lactate + NADH+H+. Note the temperature of this reaction will not affect the standard reducton potentialIn the following representation of stepwise electron flow through the respira- tory chain, replace the question marks with suitable parameters being judged. -0.4 NADH 240 -0.2 FMN, 200 0.0 160 0.2 120 0.4F cyt c 80 0.6 40 0.8 (a) ? (b) ?