Assume a protein is composed of 120 amino acid residues and that each amino acid can have three possible orientations. How many total possible orientations arethere for the protein?Express the number of possible orientations to three significant figures.ΫΠΙ ΑΣΦха хьab1.73 106●Ĵ√x x XX |X|wwwwwSubmit Previous Answers Request Answer?X.10nXorientationsThe problem is essentially asking about the possible combinations given that you are selecting one of three items a set number of times. Itmay help to think of a concrete example. If you roll a standard six-sided die, the first roll has six possible combinations. The second roll alsohas six possible combinations; however, when paired with the first there are 6 x 6 possible sets of numbers. Provided the order of thenumbers matters, when rolling a third time there are 6 x 6 × 6 possible sets of numbers. This pattern is 6" where r is the number of rolls.For this problem, there are three possible selections. There are 120 amino acids; however, consider that each possible orientation of anamino acid is due to rotation about a bond.No credit lost. Try again.

A protein's biological function depends on its three-dimensional structure. The 3D structure is…

Answered: Assume a protein is composed of 120…

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Similar questions

Part B Assume a protein is composed of 120 amino acid residues and that each amino acid can have three possible orientations. How many total possible orientations are there for the protein? Express the number of possible orientations to three significant figures. —| ΑΣΦ 1.797 • 1057 Each possible orientation of an amino acid is due to rotation about a bond. Since there are two terminal amino acids, there will be one fewer peptide bond compared to the number of amino acids. No credit lost. Try again. Submit ? Previous Answers Request Answer orientations
A researcher isolates a new protein and finds that it contains 0.755% serine by weight upon amino acid analysis. The molecular mass of serine is 105 g.mol-¹. What is the minimum molecular mass for the protein assuming only one Ser residue per protein molecule? mmin = The researcher estimates the molecular mass of the protein using gel electrophoresis. From this estimated molecular mass, the researcher concludes the protein contains 3 Ser residues. What is the estimated molecular mass of the protein as shown by gel electrophoresis? g.mol-¹ mest = g.mol-1
Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
Provide the number of polypeptide chains present andthe number of amino acid residues in each chain. for https://www.rcsb.org/structure/6j20 Provide the molecular weight of the protein orprotein complex and the total number of atoms. (All of this information can be found in the PDBpage.) Create a figure (available in the PDB page) that shows the topology of your protein, i.e.the secondary structures adopted by different regions of the protein (alpha helix, beta strand).Make sure to also provide a figure legend that helps interpret the figure and appropriate figurecaption that briefly explains the figure.
The simple average molecular weight of the 20 common amino acids is 138 , but most biochemists use 110 when estimating the number of amino acids in a protein of known molecular weight. Why do you suppose this is? (Hint: There are two contributing factors to the answer. One of them will be apparent from a brief consideration of the amino acid compositions of common proteins. See, for example, Figure -Bellow)
Proteins are composed of both polar (hydrophilic) and nonpolar (hydrophobic) amino acids. Assume you are starting with fresh homogenized/pasteurized cow's milk. A major protein in the milk is a whey protein known as alpha-lactalbumin (in a tertiary structure). If this protein is denatured (for example by the introduction of heat, acid, or other means), discuss how and why scientifically it could end up becoming an effective emulsifier in a product containing olive oil and red wine vinegar.
Look at the amino acid composition of a protein given in the table and click on the area in the 2D gel electrophoresis where you may expect the corresponding band. Amino acid composition M N P 7 3 11 A D E F G K R S V W Y ТОTAL: 16 2 12 14 4 1 3 7 2 11 11 10 1 164 Download Image. pH7 pH 9 pH3 200,000 116,250 97,400 66,200 45,000 31,000 21,500 14,400 ||| | |||
Imagine the main chain of a protein bends back on itself, so that two amino acid residues R, and R, come close to each other. In the table below are four possibilities for what R, and R, might be. In each case, decide whether a specific interaction could form between the residues. If a specific interaction could form, give the name of the interaction. R1 R2 specific interaction? name of specific interaction O yes serine tyrosine O no О yes valine threonine O no O yes threonine glutamine O no О yes cysteine cysteine no
a) Draw amino acid (L- Cysteine) and determine the net chagre at each pH (1-3-7-10-13-) b) Calculate the pl for amino acid (Cysteine) 3. This question requires you to use an amino acid with an ionizable R group. Use the Amino Acids with lonizable R Groups chart to determine which amino acid you will be using. For student number 000123456; 2-6 and using the chart for Question 3 this corresponds to Glutamic Acid. Amino Acid 3=Z= pH 1 Draw the structure of L-amino acid 3 at the pH's in the table below and determine the net charge at each pH and the gl for amino acid 3. 10 Name of amino acid 3: 13 Cysteine Structure Net Charge
In the molecule of oligomeric protein there are 19 lysine residues. 12 of them may be easily acetylated with anhydrides of dicarbon acids (it react with NH2-groups). The acetylation of extra two residues of lysine will dissociate the protein to the subunits. The rest 5 lysine residues may be modified only after denaturation of the protein. Suggest, how many lysine residues are: a) on a surface of protein globule; b) inside globule: c) in a site which is responsible for the contact within subunits
Suppose that the sequence is part of a larger globular protein. Consider the probable location, either on the external surface or the interior of the protein, of each of the amino acid residues. The table gives the hydropathy index values for selected amino acids in the peptide. Amino acid Hydropathy index alanine 1.8 isoleucine 4.5 threonine -0.7 glutamine -3.5 lysine -3.9 aspartate -3.5
The bacterially produced antibiotic gramicidin A forms channels in cell membranes that allow the free diff usion of Na+ and K+ ions, thereby killing the cell. This peptide consists of a sequence of Dand L-amino acids. The sequence of a segment of fi ve amino acids in gramicidin A is R-Gly-L-Ala-D-Leu-L-Ala-D-Val-R′. Complete the Fischer projection below by adding the correct group to each vertical bond.

SEE MORE QUESTIONS

Recommended textbooks for you

Biochemistry

ISBN:

9781319114671

Author:

Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:

W. H. Freeman

Lehninger Principles of Biochemistry

Biochemistry

ISBN:

9781464126116

Author:

David L. Nelson, Michael M. Cox

Publisher:

W. H. Freeman

Fundamentals of Biochemistry: Life at the Molecul…

Biochemistry

ISBN:

9781118918401

Author:

Donald Voet, Judith G. Voet, Charlotte W. Pratt

Publisher:

WILEY

Biochemistry

ISBN:

9781319114671

Author:

Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:

W. H. Freeman

Lehninger Principles of Biochemistry

Biochemistry

ISBN:

9781464126116

Author:

David L. Nelson, Michael M. Cox

Publisher:

W. H. Freeman

Fundamentals of Biochemistry: Life at the Molecul…

Biochemistry

ISBN:

9781118918401

Author:

Donald Voet, Judith G. Voet, Charlotte W. Pratt

Publisher:

WILEY

Biochemistry

ISBN:

9781305961135

Author:

Mary K. Campbell, Shawn O. Farrell, Owen M. McDougal

Publisher:

Cengage Learning

Biochemistry

ISBN:

9781305577206

Author:

Reginald H. Garrett, Charles M. Grisham

Publisher:

Cengage Learning

Fundamentals of General, Organic, and Biological …

Biochemistry

ISBN:

9780134015187

Author:

John E. McMurry, David S. Ballantine, Carl A. Hoeger, Virginia E. Peterson

Publisher:

PEARSON

SEE MORE TEXTBOOKS

Assume a protein is composed of 120 amino acid residues and that each amino acid can have three possible orientations. How many total possible orientations are there for the protein? Express the number of possible orientations to three significant figures. 15| ΑΣΦ xa Xb b 1.73 106 ● √x x x