Types of GSD 2- Types of GSD:Please indicate the definition of each typ.e and its cause a. I b. II c. III d. IV e. V i. VI IV. Causes of GSD V. Symptoms of GSD VI. Diagnosis of GS
Q: economic benefits of marijuana to a country
A: Cannabis, a psychoactive substance derived from the cannabis plant, is also referred to as marijuana…
Q: 10. Injecting antibodies from a human donor who is immune to a disease is ... A. natural active…
A: Immune system is responsible for giving protection against foreign pathogenic organisms. White blood…
Q: ANswer the questions related to animal nutrition: a. In poultry feed formulation, why is the ME…
A: a.In animal husbandry poultry farming mainly raises domesticated birds such as…
Q: IDENTIFY THE Darwin's and Lamarck's theories on evolution in terms of MAIN IDEA, SUPPORTING…
A: Charles Darwin and Jean-Baptiste Lamarck are both widely credited as the founders of evolutionary…
Q: What is the main source of energy for ATP replenishment for Cellular Respiration?
A: Introduction ATP or adenosine triphosphate is known as energy currency of cell. All living…
Q: mutations that happened to the cactus (eukarotic cells)
A: Mutation is a loss or sudden change in DNA sequence it happens where one or more nucleotide is…
Q: Choose the correct statements about proteins and evolution. a. Percent identity for a random…
A: "Proteins are essential for the structure, function, and regulation of cells, tissues, and organs,…
Q: You discover a new species of poison-dart frog which secretes a neurotoxin in the skin mucous with…
A: We need to figure out how the neurotoxic released by a new species of poison-dart frog works.…
Q: You are conducting an experiment with flies and establish a large population of 100 flies (pop #1).…
A: Biological drift. Genetic drift is the arbitrary change in the population's frequency of a gene…
Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…
A: Peptide 1 is migrate most slowly during size exclusion chromatography
Q: Hyperacute graft rejection is caused by Select one: A. hyperactivated helper T cells. B.…
A: Its a type of transplant rejection which occurs within minutes of organ transplant. Pre existing…
Q: Triglyceride is an important energy reserve material for human body. When sugar supply is…
A: The two processes are superficially the reverse of one another. There are, however, several…
Q: In which type of plants are Nitrogen fixing bacteria present
A: Nitrogen (N2 ) is one of the important gas presents in the atmosphere. This form of nitrogen is…
Q: Is Xiaotingia an earlier or later bird than Archaeopteryx in this tree?
A: Introduction Taxonomy is the branch of science that deals with classifying animals in hierarchical…
Q: Thioredoxin is: oxidized, reduced activity causes the: inhibition, activation enzymes by: forming,…
A: Thioredoxin reductase are important redox proteins which regulate the balance generated in…
Q: A. Illustrate. Consider the given pair of homologous DNA molecules. T T' t t' Y Y' y L L' I l' G G'…
A: Heteroduplex Double stranded DNA molecule, generated by base pairing between complimentary single…
Q: (28)The bioavailability of drug X after oral administration is 38%. Which of the following best…
A: Bioavailability in Pharmacology is defined as the fraction of the drug administration that reaches…
Q: Why is marijuana not to be legalized here in the Philippines? more info and details for debate and…
A: Marijuana is the dried leaves and flowering tops of the Cannabis sativa or Cannabis indica plant.…
Q: DISTINGUISH THE Darwin's and Lamarck's theories on evolution in terms of MAIN IDEA, SUPPORTING…
A: Introduction: Evolution is the change in the heritable characteristics of the biological…
Q: pls explain the steps that happen in the diagram only
A: Introduction:- Blood consists of formed elements and plasma as its main constituents. Formed…
Q: Cholesterol serves several essential functions in mammalian cells. Which of the following properties…
A: Cholesterol is a type of lipid with a steroid nucleus. It provides stability to the plasma membrane…
Q: Explain the transcription and processing of mRNA in the nucleus.
A: mRNA is the messenger RNA formed in the nucleus by the process of transcription. The process…
Q: List any three human activities which would lead to an increase in the carbon dioxide content of…
A: Excessive CO2 concentrations can be dangerous to people. Over 5% of CO2 in the air might result in…
Q: describe the anatomy of the eye and its accessory
A: Eyes are the organ of site of our body. These are also called as photoreceptors. These are protected…
Q: Transfer of tissue from one location to another in the same person is known as Select one: A.…
A: Organ or a tissue transplant is a technique in which organs or tissues are transplanted from either…
Q: How do each of the following contribute to genetic variation in offspring? a. Crossing over b.…
A: Genetic variation is the term used to describe how the genetic make-up of organisms within a…
Q: t is believed that the cystic fibrosis (CF) gene conferred protection to carriers during the cholera…
A: Cystic fibrosis is a genetic disorder that affects the lungs and digestive system. Symptoms include…
Q: Basic electrical rhythm or slow wave is responsible for producing motility in the smooth muscle…
A: The smooth muscles of the majority of the gastrointestinal tract are arranged into two layers of…
Q: Compare the digestive, respiratory and circulatory system of E coli bacteria and Cactus, then…
A: We all know that E.coli is a bacteria which is mainly a prokaryotic cell and Cactus is mainly a…
Q: What do we need to consider in choosing the best method in introducing recombinant DNA? Compare and…
A: DNA Recommendant Technology or genetic engineering is the branch of biotechnology which deals in…
Q: Land Use in the United States Parks and preserves 13% Urban land 6% Cropland 20% Other 7% Forest…
A: The use of land by humans is referred to as "land use." It entails transforming the wild or natural…
Q: Why two strands of DNA are not identical but are complimentary to each other?
A: Introduction Most species' genetic material is made of DNA, also known as deoxyribonucleic acid;…
Q: How does magnetic resonance imaging work?assess the benefits to society of technologies that are…
A: MRI uses powerful magnets to create strong magnetic fields that force the protons in the body to…
Q: What do you mean by greenhouse effect? Name the factors responsible for this effect and also suggest…
A: UV rays are most harmful rays which affect the living beings by alternating their DNA and proteins…
Q: What effect will a decreased heart rate have on blood pressure?• What relationship will water volume…
A: Blood pressure is a measurement of the power used by your heart to circulate blood throughout your…
Q: If a post synaptic neuron is stimulated to threshold by spatial summation this implies that Select…
A: The nervous system is composed of millions of nerve cells called neurons. Synapses are junctions…
Q: 17. How does asthma affect the respiratory tract of an animal? A. Increases their blood supply B.…
A: Asthma is a respiratory problem in which the individual will be having difficulty in breathing.…
Q: .What is mutarotation? What is the consequence of mutarotation?
A:
Q: Which of the following is a characteristic of T cell receptors?
A: Only on the cell membrane are T-cell antigen receptors to be located. Because it is made up of two…
Q: In what ways did theropods differ from modern birds? Give at least two differences.
A: Introduction Evolution is the key process which regulates the survivability and continuity of…
Q: Primary immunodeficiency disorders
A: Immunodeficiency: It is the absence or result of elements of the immune system such as phagocytes,…
Q: 10. When a primary signal needs to be sent to most cells throughout a multicellular organism, the…
A: The answers to the above questions are given below with explanation.
Q: Which of the following is the correct mRNA sequence synthesized from a DNA molecule with a coding…
A: Transcription is the initial stage in DNA-based gene expression, in which a segment of a gene's DNA…
Q: The anticodon is located in which of the labeled regions of the tRNA shown here? | C 56 20 54 44 32…
A: The tRNAs contain a second code known as anticodons that are used to decode the information, much as…
Q: What are co -enzymes ?give an example .
A: Enzymes are made up of proteins which help in increasing the metabolism or chemical reaction speed…
Q: Rejection of kidney grafts is mainly caused by Select one: A. humoral immunity. B. a combination of…
A: Cytotoxic T cells are the key immune cells that are involved in direct killing of intracellular…
Q: 13. Which of the following are secondary messengers? A) Ca2+, GTP, CAMP B) hormones C) growth…
A: When a cell is exposed to extracellular signalling molecules (first messengers), intracellular…
Q: describe hemoglobin is a protein composed of four polypeptide chains
A: Hemoglobin consists of a heme group and a globin group. The heme is the iron atom and globin is the…
Q: Describe the relationship between chromosomes, cells, and DNA 2. [Use Pictures] - How does…
A: The genetic information necessary for an organism to develop and operate is carried by the molecule…
Q: Define reproduction. How does it help in providing stability to the population of species?
A: Introduction A population is a persistent group of an interbreeding individual of a species found…
Step by step
Solved in 6 steps
- Based on your diagnosis for Ema, name and briefly summarise the rationale for 10 different medical treatments that may be required in the future for Ema. Structure this in list form.tein X Case Studies.docx X + rl=https://wheatland.orbundsis.com/einstein-freshair/Videos/0216D9403D0ED43358766A676D8A4817/Case+Stuc TCentral | NBA... a Amazon.com: Onlin... (6) The Reason Why... Isaiah Blames Zora... Beyond The Lights... Case Study, Chapter 26, The Digestive System Mr. McArthur is hospitalized with pancreatitis and cholecystitis. Neither his gallbladdernor his pancreas are functioning normally at this time. The client is placed on a NPO (nothing by mouth) diet order, given intravenous fluids and pain medication. The nurse is aware that the pancreas has two functions: one being endocrine, secretion of hormones to assist with glucose control and the other being exocrine, aiding the digestive system. Mr. McArthur is scheduled for gallbladder removal in the morning to treat the cholecystitis. (Learning Objective 4) 1. The client asks what his gallbladder does. What is the nurse's best response? 2. The client also asks how the pancreas works to help with digestion. What…31- need help with following. please be specifiy about answer
- List indications for a CVAD (there are 7)Describe indications and side effects of Escitalopram. Is it approved for use in a 15-year boy? Please answer at your own easy words. Answer should be to the point.CASE ANALYSIS: Toby is a 41-year-old patient who has cryptogenic partial epilepsy. He experienced his first seizure at age 14 and this was diagnosed as a secondary generalised attack, although discussing his history revealed he might have had complex partial seizures. Two years ago Toby was referred for assessment but it was felt that he was not a candidate for surgery. Toby was taking carbamazepine 1200mg a day and could not tolerate higher doses. Previous trials of valproate, phenytoin, phenobarbital, vigabatrin, lamotrigine, oxcarbazepine and topiramate had demonstrated little benefit. Levetiracetam was started and increased to 2500mg. Improvement in seizure control has been noted over the past 2 years with only two nocturnal complex partial seizures recorded. His current medication is levetiracetam 2500mg/day and carbamazepine 1200mg/day. DRUG THERAPY MANAGEMENT: GENERIC NAME BRAND NAME DOSAGE/ FORM FREQUENCY INDICATION FOR THE PATIENT MONITORING PARAMETERS…
- Hello good day, I am having a problem answering this question and I need your help on this. Hoping for a response and thank you In each chosen disease, pls. supply the information below: So I've chosen "Congenital Hypothyroidism", so I need a short description, its pathophysiology, laboratory diagnosis, and Treatment and Prevention of my chosen disease. a. Short Description b. Pathophysiology c. Laboratory Diagnosis d. Treatment and PreventionDescribe and evaluate the potential treatment strategies for the management of DBA and the longer-term implications and management of these patients. Page 5 of 9A DOL a Slide Show - WG DOL: Natural D X A plus.allinlearning.com/portal/assessments/routeassignment/13b3e745-1465-11eb-a9aa-06036a82e976 Show Summary Previous Next -> Which conclusion is best supported by a comparison of these two photographs? The photograph on the left shows the Confederation Bridge, which links Prince Edward Island with mainland Canada. The photograph on the right shows the Guoliang Tunnel, which cuts through the Taihang Mountains in China. A. some physical features are too difficult for humans to modify B. humans sometimes modify their environment to allow travel and the movement of goods C. it is generally easier for humans to transport goods by water than by land D. stone provides a better construction material than steel.
