different substrate (Substrate 2) with a Km = 30 µM (assuming that both substrates give the same Vmax), if [Enzyme] = 0.05 µM, calculate kcat for Substrate 1 and what is the catalytic efficiency in units of M-1s-1?

different substrate (Substrate 2) with a Km = 30 µM (assuming that both substrates give the same Vmax), if [Enzyme] = 0.05 µM, calculate kcat for Substrate 1 and what is the catalytic efficiency in units of M-1s-1?

Principles Of Radiographic Imaging: An Art And A Science

6th Edition

ISBN:9781337711067

Author:Richard R. Carlton, Arlene M. Adler, Vesna Balac

Publisher:Richard R. Carlton, Arlene M. Adler, Vesna Balac

Chapter3: Electricity

Section: Chapter Questions

Problem 7RQ

See similar textbooks

Related questions

Q: H expresses the molar concentration of hydronium ions in an queous solution on a logarithmic scale.…

A: The pH :- pH expresses the molar concentration of hydronium ions in an aqueous solution on a…

Q: What are the characteristics of a secondary antibody used in Western blotting? contains a covalently…

A: Western blotting is a laboratory technique used to detect a specific antigen containing protein in…

Q: Which plot shows the relationship between reaction rate and substrate concentration? O O Reaction…

A: Enzymes are biological catalysts that increase the rate of biochemical reactions.Most enzymes are…

Q: draw a gel with samples treated similarly with components below

A: Gel electrophoresis is a separation technique of charge molecules based on their size (molecular…

Q: 2. Consider the peptide Trp-Arg-Glu-Cys-Gly-Tyr. For the drawings requested below, please show in…

A: Recall that:Amino acid sequences are written with N-terminal amino acid on the left and C-terminal…

Q: Step 6 of the citric acid cycle is shown. Which statement best describes the role of FAD in this…

A: Citric acid cycle is a metabolic pathway that regenerates oxaloacetate from citrate. Acetyl CoA from…

Q: You will now build a 15 amino acid peptide using another paper or wire backbone as you did above.…

A: Peptides are polymers of amino acids. Proteins are primarily peptides. There are 20 general…

Q: A. If 200 mls of 0.02 M NaoH is added to 800 mls of 0.15 M phosphoric acid buffer at pH 8.2, what is…

A: The phosphoric acid buffer pH is at 8.2. So, it will be H2PO4- that will be acting as the weak acid…

Q: Choose any/all that apply to protein synthesis. Ribosomes aid in the formation of peptide bonds…

A: As per the central dogma of molecular biology, genetic information for protein synthesis is stored…

Q: Determine the net charge on the following pentapeptide "Lys-Ala-His-Asp-Ser" at: a. pH 1.0 b. pH…

A: The estimated charge on the given Lys-Ala-His-Asp-Ser peptide is +3.At low pH, the amino acid is…

Q: The two sides of the DNA double helix are connected by pairs of bases (adenine, thymine, cytosine,…

A: Consider 2 charges q1 and q2, the force between 2 charges is given by:Where,K is a constant (9×109…

Q: Using a flowchart, illustrate and differentiate the flow of the electrons in the ETC when electrons…

A: NADH produced through glycolysis is present in the cytosol of the cell. The glycolytic pathway is…

Q: Consider a protein in which a negatively charged glutamic acid side chain (pKa = 4.2) makes a salt…

A: Salt bridges are attractive interactions between two oppositely charged groups. So, more oppositely…

Q: This image shows the tertiary structure of a protein segment. Tertiary structure results from…

A: Ionic bond is formed between a positively charged and a negatively charged group. The charged groups…

Q: Identify this molecule CH₂OH H HO ОН H nucleic acid saturated fat carbohydrate phospholipid amino…

A: The molecule corresponds to a carbohydrate. It is a simplified representation of a monosaccharide,…

Q: An intermediate folding stage seen in protein denaturation or renaturation is called?

A: Proteins exist in four levels of molecular conformations in a human body: primary, secondary,…

Q: What would happen to the rate of glycolysis if there were high levels of pep in the cytosol of the…

A: Glycolysis is a collection of 10 enzymatically catalysed reactions that sequentially oxidise a…

Q: Devise a solution-phase synthesis of Ala-Leu-Val-Phe-Met, starting from the requisite Boc-protected…

A: Solution phase synthesis is a organic chemistry technique where the synthesis takes place in a…

Q: Select the choice that best describes the stereochemistry of the following amino acid, and rank the…

A: Cysteine is one of the amino acids which contains a sulphur atom in it's side chain. Like other…

Q: For a particular reaction, AH = -16.1 kJ/mol and AS° = −21.8 J/(mol·K). Assuming these values change…

A: To determine the temperature at which the reaction changes from nonspontaneous to spontaneous in the…

Q: An Fab fragment binds to lysozyme with a dissociation constant of K4 = 10 M. A 1 nM (10 M) solution…

A: Consider the following reaction: where P is the protein, L is the ligand and k1 and k2 are rate…

Q: A biochemist discovers and purifies a new enzyme, generating the purification table below. Procedure…

A: a) Specific activity =activity(in units)Total Protein(in mg)1. Crude extract =4,000,00020,000=2002.…

Q: A lysine is on the surface of a protein, near an aspartate. How does the aspartate alter the pKa of…

A: The pKa of an amino acid's side chain determines whether it is protonated (+) or deprotonated (-)…

Q: Answer the following problem and show your detailed solution and explanation. Cysteine is a…

A: 1.Titration of the Amino Group:The amino group (-NH2) in cysteine has a pKa around 9, so it will be…

Q: An amino acid that would be categorized as negatively-charged due to its side chain is shown in…

A: Amino acids are biomolecules that have a hydrogen, a carboxyl group, an amino group and a chemically…

Q: PROTEINS 1. What will happen to free arginine after being subjected to biuret analysis (is it…

A: Proteins are large, complex biomolecules composed of multiple peptide-bonded amino acids. Proteins…

Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…

A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…

Q: Acid-base catalysis two part catalytic process (for example, the chymotrypsin mechanism) a covalent…

A: Enzymes are biocatalysts which increase the rate of biochemical reactions. Substrate molecules bind…

Q: a. What is the classification of the Arabinose in terms of combined no. of carbons and highest…

A: The five-carbon sugar arabinose is extensively distributed in nature and can be the only carbon…

Q: Identify the applications for gel filtration chromatography. separation of components in a mixture…

A: Chromatography techniques are used to separate components of a mixture by the virtue of differences…

Q: Total number of H-bonds formed by water molecules in 'liquid' state are Between 3 to 4 02 3

A: We need to identify the total number of hydrogen bonds formed by water molecule in its liquid state.…

Q: Determine whether each of the examples or phrases describes an essential amino acid, a nonessential…

A: Amino acids are the monomer units of proteins. Out of the 20 general proteogenic amino acids, some…

Q: Explain why unfolding or aggregation may occur using changes in entropy and enthalpy of the protein…

A: Adding a small amount of salt into a protein solution can increase the solubility of the protein in…

Q: Sickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as…

A: d. In sickle cell anemia patients, 100% of the hemoglobin assembled contains the mutant β globin,…

Q: Substrate concentration, [S], has units of micromolar, µM. Enzyme velocity, V₁, has units of…

A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…

Q: Н H₂N-C-COOH CH2 CH2 CH₂ M OW Oc

A: Amino acids are chemical molecules that combine to produce proteins and are hence known as building…

Q: An intermediate folding stage seen in protein denaturation or renaturation is called : a) domain b)…

A: An intermediate folding stage seen in protein denaturation or renaturation is called :and option :a)…

Q: label the answer

A: Functional group is a substituent or moiety in a molecule which provides specific characteristics to…

Q: Energy Conversion Problem 1. a) Influence of concentration on the free energy change. In frog…

A: For the chemical reaction:aA + bB -> cC + dDThe reaction quotient Q is calculated as:Q = ([C]^c *…

Q: What characteristics determine the position of a protein on an IPG strip at the end of isoelectric…

A: Isoelectric focussing is a technique used for the separation of biomolecules, particularly proteins,…

Q: Fractional saturation, Y, is represented by Y = PO₂" 2 n n pO₂+ P50' The term po₂ is the partial…

A: By the equation, Y=pO2n/P50n+pO2nvalues:P50=26 torr…

Q: Consider the hypothetical serine protease, which shows the specificity pockets. The S₁ pocket has a…

A: Enzymes are biological catalysts that increasethe rate of biochemical reactions.Most enzymes are…

Q: Each of the reactions is catalyzed by an enzyme. For each reaction, classify the enzyme according to…

A: Most of the enzymes are divided into six major classes. They are1. Oxidoreductases2. Transferases3.…

Q: Select All True Statements as It Relates to the Structure Below. CH₂OH HOH2C EXE HO OH OH Г The…

A: The Compound Formed is the Result of a Reaction Between Glycerol and Amino Acid. Glycerol (a polyol…

Q: The hexokinase can be inhibited by a non competitive inhibitor. On your enzyme show where the non…

A: Hexokinase catalyzes the reaction of glucose binding to ATP to form glucose 6 phosphate. The…

Q: Modify methionine to show its zwitterion form.

A: Here an amino acid "Methionine" is given which has following structure:-

Q: Calculate the net charge of the following peptide at pH 2, pH 6 and pH 14 (use 2 and 9 as pKa values…

A: The ionizable groups in a peptide include its N-terminal alpha-amino group, C-terminal…

Q: Refer to the figure shown here, and determine the value of E for the overall oxidation/reduction…

A: Redox reaction is transfer of electrons between molecules.Both oxidation and reduction take place…

Q: A researcher isolates a new protein and finds that it contains 0.755% serine by weight upon amino…

A: A peptide is a short chain of amino acid residues linked together via a peptide bond. The peptide…

Q: You have not correctly determined what fraction of estrogen receptors is expected to be free in the…

A: Fractional saturation (Y) is the fraction of Receptors (R) that is bound by its Ligand (L). It can…

Question

Substrate 1 is plotted on the following kinetic data, the V_max and K_m for Substrate 1 are 95 uM/sec and 10 µM, respectively. Draw a curve for the data you would expect to observe for a different substrate (Substrate 2) with a Km = 30 µM (assuming that both substrates give the same Vmax), if [Enzyme] = 0.05 µM, calculate k_cat for Substrate 1 and what is the catalytic efficiency in units of M-1s-1?