Aberrant signaling through the EGF receptor signal transduction pathway drives many forms of breast cancer, while misregulation of PI3K drives many prostate cancers. PI3K is one of MANY downstream effectors of EGF receptor signaling, and there are several known activating mutations of PI3K. Would a small molecule that targets PI3K be an effective treatment for a breast cancer that is driven by aberrant signaling through the EGF receptor? Briefly explain your choice. (THIS CAN BE DONE IN LESS THAN TWO SENTENCES, AND MINIMALLY IN ABOUT EIGHT WORDS.)
Q: PCR is a molecular biology technique where template DNA is amplified using a primer and…
A: Polymerase chain reaction (PCR) is a molecular technique that is used to isolate as well as amplify…
Q: Draw the oligopeptides' structure and provide the corresponding name for each oligopeptide 1.…
A: A peptide is defined as a short chain of amino acids that are joined by peptide bond between…
Q: 12. Receptor immobalization on surfaces for developing bio-sensors
A: Immobilizing receptors on surfaces is essential to developing biosensors, which detect and quantify…
Q: What is the name of the reactant, of the TCA cycle reaction, which yields a GTP? Selected Answer:…
A: Since you have posted multiple questions, we will provide the solution only to the first five…
Q: Draw the structure of lysine in the protonation state that would predominate at pH 9.5.
A: Amino acids are the building blocks of polypeptides and proteins.Humans have 20 different amino…
Q: 367. Describe the two main mechanisms of intercellular communication and know which is the most used…
A: The two main methods of intercellular communication are direct (juxtacrine) and indirect (paracrine,…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: For a given reaction, CH3CHO+1/202 --> CH3COOH; the oxidizing agent is 02 O None of the above Осн…
A: The oxidizing agent is the species that is involved in reduction.The decrease in oxidation state is…
Q: Do you predict that this salt bridge will become stronger, become weaker, or be unaffected as pH…
A: Salt bridges are attractive interactions between two oppositely charged groups. So, more oppositely…
Q: 23. Why does DMEM separate into two distinct pH phases in a liquid?
A: Biology and biomedicine use Dulbecco's Modified Eagle Medium (DMEM) for cell culture. It provides…
Q: The products of the acid hydrolysis of a triacylglycerol (fat) are Select one: a. fatty acids and…
A: When a triacylglycerol (fat) undergoes acid hydrolysis, it is broken down into its constituent…
Q: Which of these amino acids is an acidic amino acid? (Select all that apply, if necessary.) A. B. C.…
A: Amino acid which contains more number of acid group (-COOH) than amine group (-NH2) in its…
Q: The following reaction is catalyzed by this type of enzyme? COO™ COO™ HIC-H HIC-H COO™ succinate…
A: The conversion of succinate to fumarate is an important step in the citric acid cycle (also known as…
Q: Estimate the apparent slope of the plot for myoglobin. myoglobin apparent slope = Estimate the…
A: The Hill plot is the graph we obtain by plotting at X-axis and at Y-axis. By looking at the value…
Q: Many reactions in metabolism are thermodynamically unfavorable (ie-the reaction DOES NOT favor the…
A: The thermodynamically unfavorable reaction where ∆G°>0 is driven in metabolism by coupling with…
Q: Which of the following define the stereochemistry of alanine (as per the structure shown)? Note:…
A: Amino acids are biomolecules that are comprised of two functional groups, these are an amino group…
Q: Question. Explain the signal transduction mechanism for slow ligand-gated ion channels.
A: Signal transduction mechanisms convert extracellular signals into many cellular responses,…
Q: Pepsin is the name given to a mix of several digestive enzymes secreted (as larger precursor…
A: Pepsin proteins are acidic and possess a relatively low isoelectric point (close to the pH of…
Q: An Fab fragment binds to lysozyme with a dissociation constant of Kd = 10-¹¹ M. A 1 nM (10—² M)…
A: To determine the concentration of added Fab at which half of the lysozyme will be bound to the Fab…
Q: The tripeptide Glu-Pro-Arg (EPR) which is a product of Lactobacillus casei fermentation of milk was…
A: A peptide is a name assigned to short polymers of amino acids that are less than 50. Tripeptide is…
Q: Information about poison
A: Poisons are toxic substances or chemicals which interfere the biological process and lead to failing…
Q: Draw a diagram of the tyrosine side chain. Show two ways in which the OH group of this side chain…
A: The molecular formula for the amino acid tyrosine is C9H11NO3. It features an extra hydroxyl group…
Q: In the lab where you work, a graduate student has created a K+ leak channel that is mutated in such…
A: Membrane potential is the difference in electrical charge between the inside and the outside of a…
Q: 19. Explain the three main signal transduction mechanisms for GPCRs
A: G-protein-coupled receptors (GPCRs) transmit signals from the extracellular environment to cells.…
Q: Order the following cells in terms of the size of their receptive field, from smallest to largest:…
A: The size of receptive fields generally increases as you move from early sensory processing areas to…
Q: Please identify the substrate and type of reaction, and explain how these reactions work for the…
A: Succinate Dehydrogenase and L-Amino Acid Reductase are integral components in various cellular…
Q: What is the primary driver of protein folding on a macro level? a. Hydrogen bonding b. Van der…
A: The primary driver of protein folding on a macro level is:d. Entropic forceProtein folding is…
Q: Eukaryotic cells contain many compartmentalized organelles. Label each organelle in this eukaryotic…
A: The cell is the basic unit of life. It is made up of many smaller structures called organelles.…
Q: A peptide has the sequence: Glu–His–Trp–Ser–Gly–Leu–Arg–Pro–Gly 1. What would be the net charge of…
A: The ionizable groups in a peptide include its N-terminal alpha-amino group, C-terminal…
Q: 1. If 100 mls of 0.05 M NaoH is added to 700 mls of 0.15 M glycine buffer at pH 9.4, what is the…
A: Amino acids are biomolecules that have an ionisable amino group, an ionizable carboxyl group and an…
Q: Using the pka data for lysine, draw the molecular species present at each of the following pH values…
A: Lysine has 3 ionizable groups in it. They are;alpha- carboxyl groupalpha-amino groupside chain basic…
Q: Q. How to judge which amino acids are more hydrophobic vs hydrophilic?
A: The hydrophobicity and hydrophilicity of amino acids determine their biological behavior. These…
Q: Collagen is composed of the collagen triple helix containing 1042 amino acids, How long is the…
A: Structure of Collagen: Collagen is a major structural protein in the extracellular matrix. It is…
Q: QUESTION: What do you think is the reason why body builders use amino acid to bulk their muscles up?…
A: Essential and non-essential amino acids are the two different categories of amino acids. The body…
Q: label the answer
A: Functional group is a substituent or moiety in a molecule which provides specific characteristics to…
Q: Find the connection among the words below and choose the letter of th word which is different. O A.…
A: DNA fragment separation is accomplished using the agarose gel electrophoresis technique. It…
Q: Given the following reactions or reaction conditions, determine which are spontaneous. Choose one or…
A: In thermodynamics, the spontaneity of a reaction is determined by the Gibbs free energy change (ΔG).…
Q: Amino acids project from each polypeptide backbone in a β-sheet in an alternating fashion (one above…
A: Based on affinity towards water, amino acids in given peptide can be grouped in following…
Q: What is the hydrogen bonding pattern within an alpha helix? a. Lone pair on C=O of residue i to…
A: We have to determine the hydrogen bonding pattern within an alpha helix
Q: Q. LIST INDICATORS IN THE TEST THAT CHOLESTEROL IS PRESENT.
A: Cholesterol is a lipid (fat) needed for many physiological processes. Cell membranes, hormones, and…
Q: In cytosol Enzyme 1 Enzyme 2 In mitochondria CH₂(CH₂) COOH A B C TI F F DE D E +ATP + PP₁
A: Beta-oxidation is the catabolic pathway by which fatty acids are catabolised into acetyl coA…
Q: Q. What might happen to single ssDNA if this protein was not present during replication?
A: DNA replication,replication, unwinds the double-stranded DNA molecule to reveal the two strands.…
Q: You have not correctly determined what fraction of estrogen receptors is expected to be free in the…
A: Fractional saturation (Y) is the fraction of Receptors (R) that is bound by its Ligand (L). It can…
Q: Proline provides structural regidity in proteins. What is the consequence of this on protein…
A: Of the 900 amino acids naturally occurring in nature, about 21 of them have been selected by…
Q: - Please answer properly QUESTION: In patients with Lesch Nyhan Syndrome, purine nucleotides are…
A: The body creates purines through de novo synthesis. HPRT malfunctions in people with Lesch-Nyhan…
Q: Convert the DNA template to mRNA. Then, convert the mRNA to tRNA. Based from the resulting…
A: DNA is deoxy ribo nucleic acid which is the hereditary material stored in the nucleus of a cell. The…
Q: For the enthalpy (H) factor to become favorable, the enthalpy of the products should be O Higher…
A: The question is to identify the condition of enthalpy of product with respect to reactants when the…
Q: Draw the possible ionization states for each of the following amino acids and indicate the…
A: Amino acids are simply an alpha-carbon bonded to 4 groups. The 4 groups are;an alpha-amino groupan…
Q: Which uncharged amino acids (at pH 7) have the tendency to become positively charged? O Asparagine…
A: Amino acids can exist in a variety of ionization states at different pH. The environment's pH can…
Q: × For the hydrolysis of glucose-6-phosphate, glucose-6-P + H₂O = glucose + Pi AG¹° -13.8 kJ/mol and…
A: In this coupled reaction, the hydrolysis of glucose-6-phosphate is coupled with the hydrolysis of…
Step by step
Solved in 3 steps
- Some of the most common mutations associated with cancer are found in the small G protein Ras. Oncogenic mutants of Ras lead to constitutive signaling. Suggest several possible mechanisms for why these forms of Ras show constitutive signaling. Conversely, mutations of Ras have been isolated that have dominant-negative activity (that is, they block signaling by the normal, endogenous G protein). Suggest possible mechanisms for how these mutants block signaling.Put the following steps for the outline of the growth factor signaling pathway in order: Map Kinase Kinase is Phosphorylated Proteins involved in gene transcription are activated Growth factor binds to its receptor in the cytoplasmic membrane Receptor recruits adaptor protein and GEF Autophosphorylation of tyrosine residues on the receptor Structural change of the receptor activates Tyrosine Kinase Map Kinase Kinase Kinase is phosphorylated Ras, a small GTPase, is activated by the exchange of GTP for GDP Map Kinase is Phosphorylated Map Kinase enters the nucleusTNF-alpha treatment of prostate carcinoma, LNCAP cells decreases cell survival as shown in the graph below. Which of the following would you observe in these cells treated with TNF- alpha? Select all that apply TNF-a 120 100 80 - 60 40 20 0. 24 72 (hrs) Control + TNF-a 100 ng TNFA 10 ng O Activation of extrinsic pathway of apoptosis O Activation of intrinsic pathway of apoptosis Activation of executioner caspases Recruitment of adapter protein FADD to the TNF-alpha receptor LNCAP cell viability (% of control)
- Hormone H regulates these effects via its receptors which are found at both the cell surface (csRH) and within the cell (içRH). The signalling pathways that become activated in the presence of hormone H are depicted and described below. hormone H. H H extracellular fluid inactive GTP inactive RAS Lyn cell-surface receptor for H (csR») icR GDP RAS-GTP hexose metabolism cell survival H icR G, phase (resting) Raf HK GSK-3P MEK M G2 icR - hexose kinase ERK promoter HRE CDK1 Cyclin A nucleus cyclin A Fos A promoter Created in BioRender.com bio Signalling via the cell surface receptor Hormone H mediates its cell cycle stimulatory and pro-survival effects by binding to and activating the cell surface hormone H receptor (csRH). The activated CSRH activates Lyn, which activates RAS and ultimately the Raf/MEK/ERK kinase cascade. Active ERK: o phosphorylates and inactivates GSK-3B. Inhibition of GSK-3ß promotes cell survival. inhibits p27, preventing it from inhibiting cell cycle progression.…Even in the presence of a Ras-GAP, a single amino acid change in as renders it incapable of hydrolyzing GTP. This mutation is known as Ras+ and is a cancer-causing mutation. What effect do you think this mutation will have on signaling downstream of Ras+? Why? a)A mutation would turn on the signaling pathway all of the time. b)Even if a route is mutated, it can still be turned on or off. c)Due to a mutation, the signaling pathway would always be off.I just read an abstract of the paper “Disulfide bond-disrupting agents activate the tumor necrosis family-related apoptosis-inducing ligand/death receptor 5 pathway” and noted that “DDAs and TRAIL synergize to kill cancer cells and are cytotoxic to HER2+ cancer cells with acquired resistance to the EGFR/HER2 tyrosine kinase inhibitor Lapatinib.” For the last sentence, I am not sure the meaning of the “acquired resistance to the EGFR/HER2 tyrosine kinase inhibitor Lapatinib”. Is the “acquired resistance ... to inhibitor” a good thing or bad thing, as far as the synergize effect of DDAs and TRAIL”? Hope that expert can help.
- The oscillatory clock that drives somite forma-tion in vertebrates involves three essential componentsHer7 (an unstable repressor of its own synthesis), Delta (atransmembrane signaling molecule), and Notch (a trans-membrane receptor for Delta). Notch is bound by Delta onneighboring cells, activating the Notch signaling pathway,which then activates Her7 transcription. Normally, thissystem works flawlessly to create sharply defined somites(Figure Q21–2A). In the absence of Delta, however, onlythe first five somites form normally, and the rest are poorlydefined (Figure Q21–2B). If a pulse of Delta is suppliedlater, somite formation returns to normal in the regionswhere Delta was present (Figure Q21–2C). A diagram ofthe connections between the components of the clockand how they interact in adjacent cells is shown in FigureQ21–2D. In the absence of Delta, why do the cells becomeunsynchronized? What is it about the presence of Deltathat keeps adjacent cells oscillating in synchrony?a. A typical cellular response of a mammary epithelial cell to EGF signal is proliferation. the Kd for the interaction between EGF and its receptor is 1x10^-10 M. Lets imagine that at least 25% of the receptors on a normal cell must be engaged by EGD in order to trigger the cellular proliferation response. What minimum concentration of EGF is required to reduce cell proliferation? (Show calculation). b. Mammary epithelial cancer cells have amplified levels of EGF receptors on their surface. If such a cell has 1000 EGF receptors, as compared to 200 receptors on a normal cell, what minimum concentration of EGF is required to induce cell proliferation in the cancer cell? [Show calculation]. Note that the same number of receptors (not percentage of receptors) must be activated to promote proliferation in normal cells and cancer cell. c. The ambient (unstimulated) concentration of EGF in mammary epithelial tissue is 1x10^-11 M. Will this level of EGF stimulate proliferation in normal…How would a mutation in ras that leads to formation of a Ras proteinwith no GTPase activity affect a cell’s response to insulin?
- TLRs activate NFkB, AP-1, and IRF transcription factors to induce the expression of inflammatory cytokines and type I interferons. A key feature of TLR signaling is the ability to induce inflammatory cytokine gene expression extremely rapidly following TLR stimulation. This is accomplished by signaling pathways using several mechanisms to activate transcription factors that are already present in the cell prior to TLR stimulation, but are kept in an inactive state. These signaling pathways use all of the following mechanisms EXCEPT: Induced ubiquitination leading to protein degradation Induced ubiquitination inducing protein–protein interactions Induced phosphorylation leading to nuclear translocation Induced phosphorylation leading to kinase activation Induced phosphorylation preventing protein degradationTNF-alpha treatment of prostate carcinoma, LNCAP cells decreases cell survival as shown in the graph below. Which of the following would you observe in these cells treated with TNF- alpha? Select all that apply TNF-a 120 100 80 - 60- 40- 20 - 24 72 (hrs) + Control - TNF-a 10ng + TNF-a 100 ng O Activation of extrinsic pathway of apoptosis O Activation of intrinsic pathway of apoptosis Activation of executioner caspases Recruitment of adapter protein FADD to the TNF-alpha receptor LNCAP cell viability (% of control)Identify the two general functions of the proteins encoded bytumor-suppressor genes.